Lineage for d1bhcf_ (1bhc F:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032519Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 3032520Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 3032521Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 3032558Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species)
  7. 3032559Species Cow (Bos taurus) [TaxId:9913] [57365] (86 PDB entries)
  8. 3032671Domain d1bhcf_: 1bhc F: [44528]
    dodecamer observed in the crystals
    complexed with scn

Details for d1bhcf_

PDB Entry: 1bhc (more details), 2.7 Å

PDB Description: bovine pancreatic trypsin inhibitor crystallized from thiocyanate
PDB Compounds: (F:) bovine pancreatic trypsin inhibitor

SCOPe Domain Sequences for d1bhcf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhcf_ g.8.1.1 (F:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]}
rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcg

SCOPe Domain Coordinates for d1bhcf_:

Click to download the PDB-style file with coordinates for d1bhcf_.
(The format of our PDB-style files is described here.)

Timeline for d1bhcf_: