Lineage for d1b0cb_ (1b0c B:)
- Root: SCOP 1.57
Class g: Small proteins [56992] (56 folds) 
Fold g.8: BPTI-like [57361] (1 superfamily) Superfamily g.8.1: BPTI-like [57362] (2 families) 
Family g.8.1.1: Small Kunitz-type ihibitors & BPTI-like toxins [57363] (11 proteins) Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species) Species Cow (Bos taurus) [TaxId:9913] [57365] (52 PDB entries) 
Domain d1b0cb_: 1b0c B: [44519]
Details for d1b0cb_
PDB Entry: 1b0c (more details), 2.8 Å
PDB Description: evidence of a common decamer in three crystal structures of bpti, crystallized from thiocyanate, chloride or sulfate
SCOP Domain Sequences for d1b0cb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b0cb_ g.8.1.1 (B:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus)}
rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcg
SCOP Domain Coordinates for d1b0cb_:
Click to download the PDB-style file with coordinates for d1b0cb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b0cb_:
 View in 3DDomains from other chains: (mouse over for more information) d1b0ca_, d1b0cc_, d1b0cd_, d1b0ce_ |
