Lineage for d1b0ca_ (1b0c A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032519Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 3032520Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 3032521Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 3032558Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species)
  7. 3032559Species Cow (Bos taurus) [TaxId:9913] [57365] (86 PDB entries)
  8. 3032680Domain d1b0ca_: 1b0c A: [44518]

Details for d1b0ca_

PDB Entry: 1b0c (more details), 2.8 Å

PDB Description: evidence of a common decamer in three crystal structures of bpti, crystallized from thiocyanate, chloride or sulfate
PDB Compounds: (A:) protein (pancreatic trypsin inhibitor)

SCOPe Domain Sequences for d1b0ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b0ca_ g.8.1.1 (A:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]}
rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcg

SCOPe Domain Coordinates for d1b0ca_:

Click to download the PDB-style file with coordinates for d1b0ca_.
(The format of our PDB-style files is described here.)

Timeline for d1b0ca_: