Lineage for d1bz5e_ (1bz5 E:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 622810Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 622811Superfamily g.8.1: BPTI-like [57362] (2 families) (S)
  5. 622812Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (12 proteins)
  6. 622849Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species)
  7. 622850Species Cow (Bos taurus) [TaxId:9913] [57365] (66 PDB entries)
  8. 622918Domain d1bz5e_: 1bz5 E: [44514]
    complexed with so4

Details for d1bz5e_

PDB Entry: 1bz5 (more details), 2.58 Å

PDB Description: evidence of a common decamer in three crystal structures of bpti, crystallize from thiocyanate, chloride or sulfate

SCOP Domain Sequences for d1bz5e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bz5e_ g.8.1.1 (E:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus)}
rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcg

SCOP Domain Coordinates for d1bz5e_:

Click to download the PDB-style file with coordinates for d1bz5e_.
(The format of our PDB-style files is described here.)

Timeline for d1bz5e_: