Lineage for d1bz5e_ (1bz5 E:)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 89306Fold g.8: BPTI-like [57361] (1 superfamily)
  4. 89307Superfamily g.8.1: BPTI-like [57362] (2 families) (S)
  5. 89308Family g.8.1.1: Small Kunitz-type ihibitors & BPTI-like toxins [57363] (11 proteins)
  6. 89342Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species)
  7. 89343Species Cow (Bos taurus) [TaxId:9913] [57365] (52 PDB entries)
  8. 89398Domain d1bz5e_: 1bz5 E: [44514]

Details for d1bz5e_

PDB Entry: 1bz5 (more details), 2.58 Å

PDB Description: evidence of a common decamer in three crystal structures of bpti, crystallize from thiocyanate, chloride or sulfate

SCOP Domain Sequences for d1bz5e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bz5e_ g.8.1.1 (E:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus)}
rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcg

SCOP Domain Coordinates for d1bz5e_:

Click to download the PDB-style file with coordinates for d1bz5e_.
(The format of our PDB-style files is described here.)

Timeline for d1bz5e_: