Lineage for d1bz5b_ (1bz5 B:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2259419Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2259420Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2259421Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 2259458Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species)
  7. 2259459Species Cow (Bos taurus) [TaxId:9913] [57365] (86 PDB entries)
  8. 2259550Domain d1bz5b_: 1bz5 B: [44511]
    complexed with so4

Details for d1bz5b_

PDB Entry: 1bz5 (more details), 2.58 Å

PDB Description: evidence of a common decamer in three crystal structures of bpti, crystallize from thiocyanate, chloride or sulfate
PDB Compounds: (B:) pancreatic trypsin inhibitor

SCOPe Domain Sequences for d1bz5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bz5b_ g.8.1.1 (B:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]}
rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcg

SCOPe Domain Coordinates for d1bz5b_:

Click to download the PDB-style file with coordinates for d1bz5b_.
(The format of our PDB-style files is described here.)

Timeline for d1bz5b_: