Lineage for d3tgji_ (3tgj I:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 890511Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 890512Superfamily g.8.1: BPTI-like [57362] (3 families) (S)
  5. 890513Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (12 proteins)
  6. 890551Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species)
  7. 890552Species Cow (Bos taurus) [TaxId:9913] [57365] (81 PDB entries)
  8. 890638Domain d3tgji_: 3tgj I: [44507]
    Other proteins in same PDB: d3tgje_
    complexed with ca, so4; mutant

Details for d3tgji_

PDB Entry: 3tgj (more details), 2.2 Å

PDB Description: s195a trypsinogen complexed with bovine pancreatic trypsin inhibitor (bpti)
PDB Compounds: (I:) bovine pancreatic trypsin inhibitor

SCOP Domain Sequences for d3tgji_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tgji_ g.8.1.1 (I:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]}
rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcg

SCOP Domain Coordinates for d3tgji_:

Click to download the PDB-style file with coordinates for d3tgji_.
(The format of our PDB-style files is described here.)

Timeline for d3tgji_:

890638
d3tgji_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d3tgje_