SCOP 1.57: Domain d2hexd

Root: SCOP 1.57
Class g: Small proteins [56992] (56 folds)
Fold g.8: BPTI-like [57361] (1 superfamily)
Superfamily g.8.1: BPTI-like [57362] (2 families)
Family g.8.1.1: Small Kunitz-type ihibitors & BPTI-like toxins [57363] (11 proteins)
Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species)
Species Cow (Bos taurus) [TaxId:9913] [57365] (52 PDB entries)
Domain d2hexd_: 2hex D: [44505]

PDB Entry: 2hex (more details), 2.1 Å

PDB Description: decamers observed in the crystals of bovine pancreatic trypsin inhibitor

SCOP Domain Sequences for d2hexd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hexd_ g.8.1.1 (D:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus)}
rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcg

SCOP Domain Coordinates for d2hexd_:

Click to download the PDB-style file with coordinates for d2hexd_.
(The format of our PDB-style files is described here.)

Timeline for d2hexd_:

Thumbnails for d2hexd_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2hexa_, d2hexb_, d2hexc_, d2hexe_