Lineage for d3btwi_ (3btw I:)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 748504Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 748505Superfamily g.8.1: BPTI-like [57362] (2 families) (S)
  5. 748506Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (12 proteins)
  6. 748544Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species)
  7. 748545Species Cow (Bos taurus) [TaxId:9913] [57365] (75 PDB entries)
  8. 748605Domain d3btwi_: 3btw I: [44496]
    Other proteins in same PDB: d3btwe_
    complexed with ca, so4; mutant

Details for d3btwi_

PDB Entry: 3btw (more details), 2.05 Å

PDB Description: the crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti
PDB Compounds: (I:) protein (bovine pancreatic trypsin inhibitor)

SCOP Domain Sequences for d3btwi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3btwi_ g.8.1.1 (I:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]}
dfcleppytgpcwariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga

SCOP Domain Coordinates for d3btwi_:

Click to download the PDB-style file with coordinates for d3btwi_.
(The format of our PDB-style files is described here.)

Timeline for d3btwi_: