Lineage for d3btgi_ (3btg I:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1962426Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 1962427Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 1962428Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 1962465Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species)
  7. 1962466Species Cow (Bos taurus) [TaxId:9913] [57365] (86 PDB entries)
  8. 1962530Domain d3btgi_: 3btg I: [44492]
    Other proteins in same PDB: d3btge_
    complexed with ca, so4

Details for d3btgi_

PDB Entry: 3btg (more details), 1.9 Å

PDB Description: the crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti
PDB Compounds: (I:) protein (pancreatic trypsin inhibitor)

SCOPe Domain Sequences for d3btgi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3btgi_ g.8.1.1 (I:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]}
dfcleppytgpcgariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga

SCOPe Domain Coordinates for d3btgi_:

Click to download the PDB-style file with coordinates for d3btgi_.
(The format of our PDB-style files is described here.)

Timeline for d3btgi_: