Lineage for d3btdi_ (3btd I:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2259419Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2259420Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2259421Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 2259458Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species)
  7. 2259459Species Cow (Bos taurus) [TaxId:9913] [57365] (86 PDB entries)
  8. 2259519Domain d3btdi_: 3btd I: [44485]
    Other proteins in same PDB: d3btde_
    complexed with ca, so4

Details for d3btdi_

PDB Entry: 3btd (more details), 1.9 Å

PDB Description: the crystal structures of the complexes between the bovine beta- trypsin and ten p1 variants of bpti.
PDB Compounds: (I:) protein (bovine pancreatic trypsin inhibitor)

SCOPe Domain Sequences for d3btdi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3btdi_ g.8.1.1 (I:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]}
dfcleppytgpcdariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga

SCOPe Domain Coordinates for d3btdi_:

Click to download the PDB-style file with coordinates for d3btdi_.
(The format of our PDB-style files is described here.)

Timeline for d3btdi_: