Lineage for d3btki_ (3btk I:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 622810Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 622811Superfamily g.8.1: BPTI-like [57362] (2 families) (S)
  5. 622812Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (12 proteins)
  6. 622849Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species)
  7. 622850Species Cow (Bos taurus) [TaxId:9913] [57365] (66 PDB entries)
  8. 622887Domain d3btki_: 3btk I: [44483]
    Other proteins in same PDB: d3btke_
    complexed with ca, so4

Details for d3btki_

PDB Entry: 3btk (more details), 1.85 Å

PDB Description: the crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti

SCOP Domain Sequences for d3btki_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3btki_ g.8.1.1 (I:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus)}
dfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcgga

SCOP Domain Coordinates for d3btki_:

Click to download the PDB-style file with coordinates for d3btki_.
(The format of our PDB-style files is described here.)

Timeline for d3btki_:

622887
d3btki_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d3btke_