Lineage for d3btfi_ (3btf I:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40392Fold g.8: BPTI-like [57361] (1 superfamily)
  4. 40393Superfamily g.8.1: BPTI-like [57362] (2 families) (S)
  5. 40394Family g.8.1.1: Small Kunitz-type ihibitors & BPTI-like toxins [57363] (11 proteins)
  6. 40428Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species)
  7. 40429Species Cow (Bos taurus) [TaxId:9913] [57365] (45 PDB entries)
  8. 40443Domain d3btfi_: 3btf I: [44482]
    Other proteins in same PDB: d3btfe_

Details for d3btfi_

PDB Entry: 3btf (more details), 1.8 Å

PDB Description: the crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti.

SCOP Domain Sequences for d3btfi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3btfi_ g.8.1.1 (I:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus)}
dfcleppytgpcfariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga

SCOP Domain Coordinates for d3btfi_:

Click to download the PDB-style file with coordinates for d3btfi_.
(The format of our PDB-style files is described here.)

Timeline for d3btfi_:

40443
d3btfi_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d3btfe_