SCOP 1.75: Domain d3bthi_: 3bth I:

Lineage for d3bthi_ (3bth I:)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (3 families)

5. Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (12 proteins)

6. Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [57365] (81 PDB entries)

8. Domain d3bthi_: 3bth I: [44479]
   Other proteins in same PDB: d3bthe_
   complexed with ca, so4; mutant

Details for d3bthi_

PDB Entry: 3bth, 1.75 Å

PDB Description: the crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti

PDB Compounds: (I:) protein (pancreatic trypsin inhibitor)

SCOP Domain Sequences for d3bthi_:

Sequence; same for both SEQRES and ATOM records:

>d3bthi_ g.8.1.1 (I:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]}
dfcleppytgpchariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga

Timeline for d3bthi_:

• d3bthi_ first appeared (with stable ids) in SCOP 1.55
  
• d3bthi_ appears in SCOP 1.73
  
• d3bthi_ appears in SCOPe 2.01
  
• d3bthi_ appears in the current release, SCOPe 2.08