Lineage for d1es7b_ (1es7 B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032122Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 3032123Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 3032361Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 3032362Protein BMP receptor Ia ectodomain [57359] (1 species)
  7. 3032363Species Human (Homo sapiens) [TaxId:9606] [57360] (11 PDB entries)
  8. 3032382Domain d1es7b_: 1es7 B: [44465]
    Other proteins in same PDB: d1es7a_, d1es7c_

Details for d1es7b_

PDB Entry: 1es7 (more details), 2.9 Å

PDB Description: complex between bmp-2 and two bmp receptor ia ectodomains
PDB Compounds: (B:) bone morphogenetic protein receptor ia

SCOPe Domain Sequences for d1es7b_:

Sequence, based on SEQRES records: (download)

>d1es7b_ g.7.1.3 (B:) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]}
tlpflkcycsghcpddainntcitnghcfaiieeddqgettlasgcmkyegsdfqckdsp
kaqlrrtieccrtnlcnqylqptlpp

Sequence, based on observed residues (ATOM records): (download)

>d1es7b_ g.7.1.3 (B:) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]}
tlpflkcycsghcpddainntcitnghcfaiieedettlasgcmkyegsdfqckdspkaq
lrrtieccrtnlcnqylqptlpp

SCOPe Domain Coordinates for d1es7b_:

Click to download the PDB-style file with coordinates for d1es7b_.
(The format of our PDB-style files is described here.)

Timeline for d1es7b_: