SCOP 1.55: Domain d1btea_: 1bte A:

Lineage for d1btea_ (1bte A:)

1. Root: SCOP 1.55

2. Class g: Small proteins [56992] (54 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)

4. Superfamily g.7.1: Snake toxin-like [57302] (3 families)

5. Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (3 proteins)

6. Protein Type II activin receptor [57357] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [57358] (1 PDB entry)

8. Domain d1btea_: 1bte A: [44463]

Details for d1btea_

PDB Entry: 1bte, 1.5 Å

PDB Description: crystal structure of the extracellular domain of the type ii activin receptor

SCOP Domain Sequences for d1btea_:

Sequence, based on SEQRES records:

>d1btea_ g.7.1.3 (A:) Type II activin receptor {Mouse (Mus musculus)}
etqeclffnanwerdrtnqtgvepcygdkdkrrhcfatwknisgsieivkqgcwlddinc
ydrtdciekkdspevyfcccegnmcnekfsyfpeme

Sequence, based on observed residues (ATOM records):

>d1btea_ g.7.1.3 (A:) Type II activin receptor {Mouse (Mus musculus)}
etqeclffnanwerdrtnqtgvepcygrrhcfatwknisgsieivkqgcwlddincydrt
dciekkdspevyfcccegnmcnekfsyfpeme

Timeline for d1btea_:

• d1btea_ appears in SCOP 1.57
  
• d1btea_ appears in the current release, SCOPe 2.08