Lineage for d1erga_ (1erg A:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1062938Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 1062939Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 1063138Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (7 proteins)
  6. 1063150Protein CD59 [57355] (1 species)
  7. 1063151Species Human (Homo sapiens) [TaxId:9606] [57356] (6 PDB entries)
  8. 1063158Domain d1erga_: 1erg A: [44462]

Details for d1erga_

PDB Entry: 1erg (more details)

PDB Description: three-dimensional solution structure of the extracellular region of the complement regulatory protein, cd59, a new cell surface protein domain related to neurotoxins
PDB Compounds: (A:) cd59

SCOPe Domain Sequences for d1erga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1erga_ g.7.1.3 (A:) CD59 {Human (Homo sapiens) [TaxId: 9606]}
lqcyncpnptadcktavncssdfdaclitkaglqvynkcwkfehcnfndvttrlrenelt
yycckkdlcn

SCOPe Domain Coordinates for d1erga_:

Click to download the PDB-style file with coordinates for d1erga_.
(The format of our PDB-style files is described here.)

Timeline for d1erga_: