SCOPe 2.01: Domain d1erga_: 1erg A:

Lineage for d1erga_ (1erg A:)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (7 proteins)

6. Protein CD59 [57355] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57356] (6 PDB entries)

8. Domain d1erga_: 1erg A: [44462]

Details for d1erga_

PDB Entry: 1erg

PDB Description: three-dimensional solution structure of the extracellular region of the complement regulatory protein, cd59, a new cell surface protein domain related to neurotoxins

PDB Compounds: (A:) cd59

SCOPe Domain Sequences for d1erga_:

Sequence; same for both SEQRES and ATOM records:

>d1erga_ g.7.1.3 (A:) CD59 {Human (Homo sapiens) [TaxId: 9606]}
lqcyncpnptadcktavncssdfdaclitkaglqvynkcwkfehcnfndvttrlrenelt
yycckkdlcn

Timeline for d1erga_:

• d1erga_ first appeared (with stable ids) in SCOP 1.55, called d1erg__
  
• d1erga_ appears in SCOP 1.75
  
• d1erga_ appears in SCOPe 2.02
  
• d1erga_ appears in the current release, SCOPe 2.08