| Class g: Small proteins [56992] (90 folds) |
| Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
Superfamily g.7.1: Snake toxin-like [57302] (4 families) ![]() |
| Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (7 proteins) |
| Protein CD59 [57355] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [57356] (6 PDB entries) |
| Domain d1cdqa_: 1cdq A: [44459] |
PDB Entry: 1cdq (more details)
SCOPe Domain Sequences for d1cdqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cdqa_ g.7.1.3 (A:) CD59 {Human (Homo sapiens) [TaxId: 9606]}
lqcyncpnptadcktavncssdfdaclitkaglqvynkcwkfehcnfndvttrlrenelt
yycckkdlcnfneqlen
Timeline for d1cdqa_: