Class g: Small proteins [56992] (72 folds) |
Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
Superfamily g.7.1: Snake toxin-like [57302] (3 families) |
Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (4 proteins) |
Protein CD59 [57355] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57356] (5 PDB entries) |
Domain d1cdq__: 1cdq - [44459] |
PDB Entry: 1cdq (more details)
SCOP Domain Sequences for d1cdq__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cdq__ g.7.1.3 (-) CD59 {Human (Homo sapiens)} lqcyncpnptadcktavncssdfdaclitkaglqvynkcwkfehcnfndvttrlrenelt yycckkdlcnfneqlen
Timeline for d1cdq__: