Lineage for d1coe__ (1coe -)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.7: Snake toxin-like [57301] (1 superfamily) Superfamily g.7.1: Snake toxin-like [57302] (3 families) 
Family g.7.1.1: Snake venom toxins [57303] (21 proteins) 
Protein Cobrotoxin II (ct2) [57341] (2 species) 
Species Taiwan cobra (Naja naja atra) [TaxId:8656] [57342] (2 PDB entries) 
Domain d1coe__: 1coe - [44450]
Details for d1coe__
PDB Entry: 1coe (more details)
PDB Description: solution conformation of cobrotoxin: a nuclear magnetic resonance and hybrid distance geometry-dynamical simulated annealing study
SCOP Domain Sequences for d1coe__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1coe__ g.7.1.1 (-) Cobrotoxin II (ct2) {Taiwan cobra (Naja naja atra)}
lechnqqssqtptttgcsggetncykkrwrdhrgyrtergcgcpsvkngieinccttdrc
nn
SCOP Domain Coordinates for d1coe__:
Click to download the PDB-style file with coordinates for d1coe__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1coe__:
- d1coe__ appears in SCOP 1.57
- d1coe__ appears in the current release, SCOPe 2.08, called d1coea_
View in 3D