Lineage for d1coea_ (1coe A:)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. Protein Cobrotoxin II (ct2) [57341] (2 species)
  7. Species Taiwan cobra (Naja naja atra) [TaxId:8656] [57342] (3 PDB entries)
    Uniprot P60770 22-83
  8. Domain d1coea_: 1coe A: [44450]

Details for d1coea_

PDB Entry: 1coe (more details)

PDB Description: solution conformation of cobrotoxin: a nuclear magnetic resonance and hybrid distance geometry-dynamical simulated annealing study
PDB Compounds: (A:) cobrotoxin

SCOPe Domain Sequences for d1coea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1coea_ g.7.1.1 (A:) Cobrotoxin II (ct2) {Taiwan cobra (Naja naja atra) [TaxId: 8656]}
lechnqqssqtptttgcsggetncykkrwrdhrgyrtergcgcpsvkngieinccttdrc
nn

SCOPe Domain Coordinates for d1coea_ are not available.

Timeline for d1coea_: