Lineage for d1cb9a_ (1cb9 A:)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. Protein Cardiotoxin II [57334] (2 species)
  7. Species Central asian cobra (Naja naja oxiana) [TaxId:8657] [57336] (3 PDB entries)
  8. Domain d1cb9a_: 1cb9 A: [44442]

Details for d1cb9a_

PDB Entry: 1cb9 (more details)

PDB Description: nmr structure with tightly bound water molecules of cytotoxin ii (cardiotoxin) from naja naja oxiana in aqueous solution (major form).
PDB Compounds: (A:) protein (cytotoxin 2)

SCOPe Domain Sequences for d1cb9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cb9a_ g.7.1.1 (A:) Cardiotoxin II {Central asian cobra (Naja naja oxiana) [TaxId: 8657]}
lkckklvplfsktcpagknlcykmfmvaaphvpvkrgcidvcpkssllvkyvccntdkcn

SCOPe Domain Coordinates for d1cb9a_ are not available.

Timeline for d1cb9a_: