Lineage for d2cdxa_ (2cdx A:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1702133Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 1702134Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 1702135Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 1702208Protein Cardiotoxin CTXI [57330] (1 species)
  7. 1702209Species Taiwan cobra (Naja naja atra) [TaxId:8656] [57331] (1 PDB entry)
  8. 1702210Domain d2cdxa_: 2cdx A: [44436]

Details for d2cdxa_

PDB Entry: 2cdx (more details)

PDB Description: structure of cobra cardiotoxin ctxi as derived from nuclear magnetic resonance spectroscopy and distance geometry calculations
PDB Compounds: (A:) cardiotoxin ctx I

SCOPe Domain Sequences for d2cdxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cdxa_ g.7.1.1 (A:) Cardiotoxin CTXI {Taiwan cobra (Naja naja atra) [TaxId: 8656]}
lkcnklipiasktcpagknlcykmfmmsdltipvkrgcidvcpknsllvkyvccntdrcn

SCOPe Domain Coordinates for d2cdxa_:

Click to download the PDB-style file with coordinates for d2cdxa_.
(The format of our PDB-style files is described here.)

Timeline for d2cdxa_: