SCOPe 2.08: Domain d2nbtb_: 2nbt B:

Lineage for d2nbtb_ (2nbt B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
   automatically mapped to Pfam PF00087

6. Protein Bungarotoxin [57324] (4 species)

7. Species Many-banded krait (Bungarus multicinctus), neuronal bungarotoxin [TaxId:8616] [57327] (1 PDB entry)

8. Domain d2nbtb_: 2nbt B: [44434]

Details for d2nbtb_

PDB Entry: 2nbt

PDB Description: neuronal bungarotoxin, nmr, 10 structures

PDB Compounds: (B:) neuronal bungarotoxin

SCOPe Domain Sequences for d2nbtb_:

Sequence; same for both SEQRES and ATOM records:

>d2nbtb_ g.7.1.1 (B:) Bungarotoxin {Many-banded krait (Bungarus multicinctus), neuronal bungarotoxin [TaxId: 8616]}
rtclispsstpqtcpngqdicflkaqcdkfcsirgpvieqgcvatcpqfrsnyrsllcct
tdncnh

Timeline for d2nbtb_:

• d2nbtb_ first appeared (with stable ids) in SCOP 1.55
  
• d2nbtb_ appears in SCOPe 2.07