Lineage for d1kbab_ (1kba B:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40254Fold g.7: Snake toxin-like [57301] (1 superfamily)
  4. 40255Superfamily g.7.1: Snake toxin-like [57302] (3 families) (S)
  5. 40256Family g.7.1.1: Snake venom toxins [57303] (21 proteins)
  6. 40269Protein Bungarotoxin [57324] (3 species)
  7. 40278Species Kappa-bungarotoxin (Bungarus multicinctus) [57326] (1 PDB entry)
  8. 40280Domain d1kbab_: 1kba B: [44432]

Details for d1kbab_

PDB Entry: 1kba (more details), 2.3 Å

PDB Description: crystal structure of kappa-bungarotoxin at 2.3-angstrom resolution

SCOP Domain Sequences for d1kbab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbab_ g.7.1.1 (B:) Bungarotoxin {Kappa-bungarotoxin (Bungarus multicinctus)}
rtclispsstpqtcpngqdicflkaqcdkfcsirgpvieqgcvatcpqfrsnyrsllcct
tdncnh

SCOP Domain Coordinates for d1kbab_:

Click to download the PDB-style file with coordinates for d1kbab_.
(The format of our PDB-style files is described here.)

Timeline for d1kbab_:

40280
d1kbab_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1kbaa_