Lineage for d1kbab_ (1kba B:)
- Root: SCOPe 2.08
Class g: Small proteins [56992] (100 folds) 
Fold g.7: Snake toxin-like [57301] (1 superfamily)
disulfide-rich fold: nearly all-betaSuperfamily g.7.1: Snake toxin-like [57302] (4 families) 
Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
automatically mapped to Pfam PF00087
Protein Bungarotoxin [57324] (4 species) 
Species Many-banded krait (Bungarus multicinctus), kappa-bungarotoxin [TaxId:8616] [57326] (1 PDB entry) 
Domain d1kbab_: 1kba B: [44432]
Details for d1kbab_
PDB Entry: 1kba (more details), 2.3 Å
PDB Description: crystal structure of kappa-bungarotoxin at 2.3-angstrom resolution
PDB Compounds: (B:) kappa-bungarotoxinSCOPe Domain Sequences for d1kbab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kbab_ g.7.1.1 (B:) Bungarotoxin {Many-banded krait (Bungarus multicinctus), kappa-bungarotoxin [TaxId: 8616]}
rtclispsstpqtcpngqdicflkaqcdkfcsirgpvieqgcvatcpqfrsnyrsllcct
tdncnh
SCOPe Domain Coordinates for d1kbab_:
Click to download the PDB-style file with coordinates for d1kbab_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kbab_:
- d1kbab_ first appeared (with stable ids) in SCOP 1.55
- d1kbab_ appears in SCOPe 2.07
View in 3D
