Lineage for d1hoya_ (1hoy A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2259038Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 2259039Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 2259040Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 2259071Protein Bungarotoxin [57324] (4 species)
  7. 2259072Species Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId:8616] [57325] (26 PDB entries)
  8. 2259093Domain d1hoya_: 1hoy A: [44429]
    complexed with a mimotope of the nicotinic acetylcholine receptor, chain B

Details for d1hoya_

PDB Entry: 1hoy (more details)

PDB Description: nmr structure of the complex between a-bungarotoxin and a mimotope of the nicotinic acetylcholine receptor
PDB Compounds: (A:) long neurotoxin 1

SCOPe Domain Sequences for d1hoya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hoya_ g.7.1.1 (A:) Bungarotoxin {Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId: 8616]}
ivchttatspisavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc
stdkcnphpkqrpg

SCOPe Domain Coordinates for d1hoya_:

Click to download the PDB-style file with coordinates for d1hoya_.
(The format of our PDB-style files is described here.)

Timeline for d1hoya_: