Lineage for d1hoya_ (1hoy A:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40254Fold g.7: Snake toxin-like [57301] (1 superfamily)
  4. 40255Superfamily g.7.1: Snake toxin-like [57302] (3 families) (S)
  5. 40256Family g.7.1.1: Snake venom toxins [57303] (21 proteins)
  6. 40269Protein Bungarotoxin [57324] (3 species)
  7. 40270Species Alpha-bungarotoxin (Bungarus multicinctus) [57325] (6 PDB entries)
  8. 40276Domain d1hoya_: 1hoy A: [44429]

Details for d1hoya_

PDB Entry: 1hoy (more details)

PDB Description: nmr structure of the complex between a-bungarotoxin and a mimotope of the nicotinic acetylcholine receptor

SCOP Domain Sequences for d1hoya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hoya_ g.7.1.1 (A:) Bungarotoxin {Alpha-bungarotoxin (Bungarus multicinctus)}
ivchttatspisavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc
stdkcnphpkqrpg

SCOP Domain Coordinates for d1hoya_:

Click to download the PDB-style file with coordinates for d1hoya_.
(The format of our PDB-style files is described here.)

Timeline for d1hoya_: