Lineage for d1abta_ (1abt A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2636873Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 2636874Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 2636875Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 2636906Protein Bungarotoxin [57324] (4 species)
  7. 2636907Species Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId:8616] [57325] (26 PDB entries)
  8. 2636923Domain d1abta_: 1abt A: [44426]

Details for d1abta_

PDB Entry: 1abt (more details)

PDB Description: nmr solution structure of an alpha-bungarotoxin(slash)nicotinic receptor peptide complex
PDB Compounds: (A:) alpha-bungarotoxin

SCOPe Domain Sequences for d1abta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1abta_ g.7.1.1 (A:) Bungarotoxin {Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId: 8616]}
ivchttatspisavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc
stdkcnphpkqrpg

SCOPe Domain Coordinates for d1abta_:

Click to download the PDB-style file with coordinates for d1abta_.
(The format of our PDB-style files is described here.)

Timeline for d1abta_: