![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
![]() | Superfamily g.7.1: Snake toxin-like [57302] (4 families) ![]() |
![]() | Family g.7.1.1: Snake venom toxins [57303] (28 proteins) automatically mapped to Pfam PF00087 |
![]() | Protein Bungarotoxin [57324] (4 species) |
![]() | Species Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId:8616] [57325] (26 PDB entries) |
![]() | Domain d1abta_: 1abt A: [44426] |
PDB Entry: 1abt (more details)
SCOPe Domain Sequences for d1abta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1abta_ g.7.1.1 (A:) Bungarotoxin {Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId: 8616]} ivchttatspisavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc stdkcnphpkqrpg
Timeline for d1abta_: