Lineage for d1abta_ (1abt A:)
- Root: SCOP 1.59
Class g: Small proteins [56992] (58 folds) 
Fold g.7: Snake toxin-like [57301] (1 superfamily) Superfamily g.7.1: Snake toxin-like [57302] (3 families) 
Family g.7.1.1: Snake venom toxins [57303] (22 proteins) 
Protein Bungarotoxin [57324] (3 species) Species Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId:8616] [57325] (15 PDB entries) 
Domain d1abta_: 1abt A: [44426]
Details for d1abta_
PDB Entry: 1abt (more details)
PDB Description: nmr solution structure of an alpha-bungarotoxin(slash)nicotinic receptor peptide complex
SCOP Domain Sequences for d1abta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1abta_ g.7.1.1 (A:) Bungarotoxin {Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin}
ivchttatspisavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc
stdkcnphpkqrpg
SCOP Domain Coordinates for d1abta_:
Click to download the PDB-style file with coordinates for d1abta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1abta_:
- d1abta_ first appeared (with stable ids) in SCOP 1.55
- d1abta_ appears in SCOP 1.57
- d1abta_ appears in SCOP 1.61
- d1abta_ appears in the current release, SCOPe 2.08
View in 3D