SCOPe 2.05: Domain d2abxb_: 2abx B:

Lineage for d2abxb_ (2abx B:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
   automatically mapped to Pfam PF00087

6. Protein Bungarotoxin [57324] (4 species)

7. Species Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId:8616] [57325] (23 PDB entries)

8. Domain d2abxb_: 2abx B: [44425]

Details for d2abxb_

PDB Entry: 2abx, 2.5 Å

PDB Description: the crystal structure of alpha-bungarotoxin at 2.5 angstroms resolution. relation to solution structure and binding to acetylcholine receptor

PDB Compounds: (B:) alpha-bungarotoxin

SCOPe Domain Sequences for d2abxb_:

Sequence; same for both SEQRES and ATOM records:

>d2abxb_ g.7.1.1 (B:) Bungarotoxin {Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId: 8616]}
ivchttatipssavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc
stdkcnhppkrqpg

Timeline for d2abxb_:

• d2abxb_ first appeared (with stable ids) in SCOP 1.55
  
• d2abxb_ appears in SCOPe 2.04
  
• d2abxb_ appears in SCOPe 2.06
  
• d2abxb_ appears in the current release, SCOPe 2.08