SCOPe 2.04: Domain d1ctxa_: 1ctx A:

Lineage for d1ctxa_ (1ctx A:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
   automatically mapped to Pfam PF00087

6. Protein alpha-Cobratoxin [57318] (3 species)

7. Species Cobra (Naja siamensis) [TaxId:84476] [57319] (3 PDB entries)

8. Domain d1ctxa_: 1ctx A: [44421]

Details for d1ctxa_

PDB Entry: 1ctx, 2.8 Å

PDB Description: three-dimensional structure of the-long-neurotoxin from cobra venom

PDB Compounds: (A:) alpha-cobratoxin

SCOPe Domain Sequences for d1ctxa_:

Sequence; same for both SEQRES and ATOM records:

>d1ctxa_ g.7.1.1 (A:) alpha-Cobratoxin {Cobra (Naja siamensis) [TaxId: 84476]}
ircfitpditskdcpnghvcytktwcdafcsirgkrvdlgcaatcptvktgvdiqccstd
ncnpfptrkrp

Timeline for d1ctxa_:

• d1ctxa_ first appeared (with stable ids) in SCOP 1.55, called d1ctx__
  
• d1ctxa_ appears in SCOPe 2.03
  
• d1ctxa_ appears in SCOPe 2.05
  
• d1ctxa_ appears in the current release, SCOPe 2.08