Lineage for d1kxia_ (1kxi A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2259038Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 2259039Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 2259040Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 2259153Protein Cardiotoxin V [57316] (1 species)
  7. 2259154Species Taiwan cobra (Naja naja atra) [TaxId:8656] [57317] (2 PDB entries)
  8. 2259155Domain d1kxia_: 1kxi A: [44417]

Details for d1kxia_

PDB Entry: 1kxi (more details), 2.19 Å

PDB Description: structure of cytotoxin homolog precursor
PDB Compounds: (A:) cardiotoxin v

SCOPe Domain Sequences for d1kxia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kxia_ g.7.1.1 (A:) Cardiotoxin V {Taiwan cobra (Naja naja atra) [TaxId: 8656]}
lkchntqlpfiyktcpegknlcfkatlkkfplkfpvkrgcadncpknsallkyvccstdk
cn

SCOPe Domain Coordinates for d1kxia_:

Click to download the PDB-style file with coordinates for d1kxia_.
(The format of our PDB-style files is described here.)

Timeline for d1kxia_:

2259155
d1kxia_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1kxib_