Class g: Small proteins [56992] (94 folds) |
Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
Superfamily g.7.1: Snake toxin-like [57302] (4 families) |
Family g.7.1.1: Snake venom toxins [57303] (28 proteins) automatically mapped to Pfam PF00087 |
Protein Fasciculin [57308] (1 species) different isoforms |
Species Green mamba (Dendroaspis angusticeps) [TaxId:8618] [57309] (11 PDB entries) |
Domain d1fsca_: 1fsc A: [44404] complexed with unl |
PDB Entry: 1fsc (more details), 2 Å
SCOPe Domain Sequences for d1fsca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fsca_ g.7.1.1 (A:) Fasciculin {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} tmcyshtttsrailtncgenscyrksrrhppkmvlgrgcgcppgddnlevkcctspdkcn y
Timeline for d1fsca_: