Lineage for d1fasa_ (1fas A:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1702133Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 1702134Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 1702135Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 1702282Protein Fasciculin [57308] (1 species)
    different isoforms
  7. 1702283Species Green mamba (Dendroaspis angusticeps) [TaxId:8618] [57309] (11 PDB entries)
  8. 1702284Domain d1fasa_: 1fas A: [44403]

Details for d1fasa_

PDB Entry: 1fas (more details), 1.8 Å

PDB Description: 1.9 angstrom resolution structure of fasciculin 1, an anti- acetylcholinesterase toxin from green mamba snake venom
PDB Compounds: (A:) fasciculin 1

SCOPe Domain Sequences for d1fasa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fasa_ g.7.1.1 (A:) Fasciculin {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]}
tmcyshtttsrailtncgenscyrksrrhppkmvlgrgcgcppgddylevkcctspdkcn
y

SCOPe Domain Coordinates for d1fasa_:

Click to download the PDB-style file with coordinates for d1fasa_.
(The format of our PDB-style files is described here.)

Timeline for d1fasa_: