SCOPe 2.04: Domain d1tgxb_: 1tgx B:

Lineage for d1tgxb_ (1tgx B:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
   automatically mapped to Pfam PF00087

6. Protein gamma-Cardiotoxin [57306] (1 species)

7. Species Snake (Naja nigricollis) [TaxId:8654] [57307] (3 PDB entries)

8. Domain d1tgxb_: 1tgx B: [44399]
   complexed with cl

Details for d1tgxb_

PDB Entry: 1tgx, 1.55 Å

PDB Description: x-ray structure at 1.55 a of toxin gamma, a cardiotoxin from naja nigricollis venom. crystal packing reveals a model for insertion into membranes

PDB Compounds: (B:) gamma-cardiotoxin

SCOPe Domain Sequences for d1tgxb_:

Sequence; same for both SEQRES and ATOM records:

>d1tgxb_ g.7.1.1 (B:) gamma-Cardiotoxin {Snake (Naja nigricollis) [TaxId: 8654]}
lkcnqlippfwktcpkgknlcykmtmraapmvpvkrgcidvcpkssllikymccntdkcn

Timeline for d1tgxb_:

• d1tgxb_ first appeared (with stable ids) in SCOP 1.55
  
• d1tgxb_ appears in SCOPe 2.03
  
• d1tgxb_ appears in SCOPe 2.05
  
• d1tgxb_ appears in the current release, SCOPe 2.08