Lineage for d1eraa_ (1era A:)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. Protein Erabutoxin B (also neurotoxin B) [57304] (1 species)
  7. Species Sea snake (Laticauda semifasciata) [TaxId:8631] [57305] (7 PDB entries)
  8. Domain d1eraa_: 1era A: [44397]

Details for d1eraa_

PDB Entry: 1era (more details)

PDB Description: tertiary structure of erabutoxin b in aqueous solution elucidated by two-dimensional nuclear magnetic resonance
PDB Compounds: (A:) erabutoxin b

SCOPe Domain Sequences for d1eraa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eraa_ g.7.1.1 (A:) Erabutoxin B (also neurotoxin B) {Sea snake (Laticauda semifasciata) [TaxId: 8631]}
ricfnhqssqpqttktcspgesscyhkqwsdfrgtiiergcgcptvkpgiklsccesevc
nn

SCOPe Domain Coordinates for d1eraa_ are not available.

Timeline for d1eraa_: