Lineage for d1qkdb_ (1qkd B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032122Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 3032123Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 3032124Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 3032263Protein Erabutoxin B (also neurotoxin B) [57304] (1 species)
  7. 3032264Species Sea snake (Laticauda semifasciata) [TaxId:8631] [57305] (7 PDB entries)
  8. 3032266Domain d1qkdb_: 1qkd B: [44391]

Details for d1qkdb_

PDB Entry: 1qkd (more details), 1.49 Å

PDB Description: erabutoxin
PDB Compounds: (B:) erabutoxin a

SCOPe Domain Sequences for d1qkdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qkdb_ g.7.1.1 (B:) Erabutoxin B (also neurotoxin B) {Sea snake (Laticauda semifasciata) [TaxId: 8631]}
ricfnhqssqpqttktcspgesscynkqwsdfrgtiiergcgcptvkpgiklsccesevc
nn

SCOPe Domain Coordinates for d1qkdb_:

Click to download the PDB-style file with coordinates for d1qkdb_.
(The format of our PDB-style files is described here.)

Timeline for d1qkdb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qkda_