![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.15: Leech antihemostatic proteins [57262] (3 families) ![]() |
![]() | Family g.3.15.2: Hirudin-like [57270] (4 proteins) |
![]() | Protein Haemadin [57275] (1 species) |
![]() | Species Indian leech (Haemadipsa sylvestris) [TaxId:13555] [57276] (1 PDB entry) |
![]() | Domain d1e0fk_: 1e0f K: [44379] Other proteins in same PDB: d1e0f.1, d1e0f.2, d1e0f.3 |
PDB Entry: 1e0f (more details), 3.1 Å
SCOPe Domain Sequences for d1e0fk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e0fk_ g.3.15.2 (K:) Haemadin {Indian leech (Haemadipsa sylvestris) [TaxId: 13555]} irfgmgkvpcpdgevgytcdcgekiclygqscndgqcsgdpkpssefeefeideeek
Timeline for d1e0fk_: