Lineage for d1e0fi_ (1e0f I:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39579Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)
  4. 40181Superfamily g.3.15: Leech antihemostatic proteins [57262] (2 families) (S)
  5. 40202Family g.3.15.2: Hirudin-like [57270] (3 proteins)
  6. 40206Protein Haemadin [57275] (1 species)
  7. 40207Species Indian leech (Haemadipsa sylvestris) [TaxId:13555] [57276] (1 PDB entry)
  8. 40208Domain d1e0fi_: 1e0f I: [44377]
    Other proteins in same PDB: d1e0f.1, d1e0f.2, d1e0f.3

Details for d1e0fi_

PDB Entry: 1e0f (more details), 3.1 Å

PDB Description: crystal structure of the human alpha-thrombin-haemadin complex: an exosite ii-binding inhibitor

SCOP Domain Sequences for d1e0fi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0fi_ g.3.15.2 (I:) Haemadin {Indian leech (Haemadipsa sylvestris)}
irfgmgkvpcpdgevgytcdcgekiclygqscndgqcsgdpkpssefeefeideeek

SCOP Domain Coordinates for d1e0fi_:

Click to download the PDB-style file with coordinates for d1e0fi_.
(The format of our PDB-style files is described here.)

Timeline for d1e0fi_: