Lineage for d4htci_ (4htc I:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2581531Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2583429Superfamily g.3.15: Leech antihemostatic proteins [57262] (3 families) (S)
  5. 2583451Family g.3.15.2: Hirudin-like [57270] (4 protein domains)
  6. 2583460Protein Hirudin [57271] (1 species)
  7. 2583461Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [57272] (9 PDB entries)
  8. 2583465Domain d4htci_: 4htc I: [44368]
    Other proteins in same PDB: d4htc.1
    complexed with nag

Details for d4htci_

PDB Entry: 4htc (more details), 2.3 Å

PDB Description: the refined structure of the hirudin-thrombin complex
PDB Compounds: (I:) hirudin variant 2

SCOPe Domain Sequences for d4htci_:

Sequence, based on SEQRES records: (download)

>d4htci_ g.3.15.2 (I:) Hirudin {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}
itytdctesgqnlclcegsnvcgkgnkcilgsngkgnqcvtgegtpkpeshnngdfeeip
eeylq

Sequence, based on observed residues (ATOM records): (download)

>d4htci_ g.3.15.2 (I:) Hirudin {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}
itytdctesgqnlclcegsnvcgkgnkcilggnqcvtgegtpkpeshnngdfeeipeeyl
q

SCOPe Domain Coordinates for d4htci_:

Click to download the PDB-style file with coordinates for d4htci_.
(The format of our PDB-style files is described here.)

Timeline for d4htci_: