Lineage for d1c9pb_ (1c9p B:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1061532Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1062825Superfamily g.3.15: Leech antihemostatic proteins [57262] (3 families) (S)
  5. 1062826Family g.3.15.1: Huristasin-like [57263] (3 proteins)
  6. 1062827Protein Bdellastasin [57266] (1 species)
  7. 1062828Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [57267] (3 PDB entries)
  8. 1062830Domain d1c9pb_: 1c9p B: [44359]
    Other proteins in same PDB: d1c9pa_
    complexed with ca

Details for d1c9pb_

PDB Entry: 1c9p (more details), 2.8 Å

PDB Description: complex of bdellastasin with porcine trypsin
PDB Compounds: (B:) bdellastasin

SCOPe Domain Sequences for d1c9pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c9pb_ g.3.15.1 (B:) Bdellastasin {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}
cgpvtcsgaqmcevdkcvcsdlhckvkcehgfkkddngceyacicadapq

SCOPe Domain Coordinates for d1c9pb_:

Click to download the PDB-style file with coordinates for d1c9pb_.
(The format of our PDB-style files is described here.)

Timeline for d1c9pb_: