Lineage for d1bx7a_ (1bx7 A:)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. Superfamily g.3.15: Leech antihemostatic proteins [57262] (3 families) (S)
  5. Family g.3.15.1: Huristasin-like [57263] (3 proteins)
  6. Protein Hirustasin [57264] (1 species)
  7. Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [57265] (3 PDB entries)
  8. Domain d1bx7a_: 1bx7 A: [44355]
    complexed with so4

Details for d1bx7a_

PDB Entry: 1bx7 (more details), 1.2 Å

PDB Description: hirustasin from hirudo medicinalis at 1.2 angstroms
PDB Compounds: (A:) hirustasin

SCOPe Domain Sequences for d1bx7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bx7a_ g.3.15.1 (A:) Hirustasin {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}
gntcggetcsaaqvclkgkcvcnevhcrirckyglkkdengceypcscaka

SCOPe Domain Coordinates for d1bx7a_ are not available.

Timeline for d1bx7a_: