Lineage for d1flei_ (1fle I:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2581531Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2583416Superfamily g.3.14: Elafin-like [57256] (2 families) (S)
    automatically mapped to Pfam PF00095
  5. 2583417Family g.3.14.1: Elafin-like [57257] (3 proteins)
  6. 2583418Protein Elafin, elastase-specific inhibitor [57258] (1 species)
  7. 2583419Species Human (Homo sapiens) [TaxId:9606] [57259] (2 PDB entries)
  8. 2583420Domain d1flei_: 1fle I: [44352]
    Other proteins in same PDB: d1flee_

Details for d1flei_

PDB Entry: 1fle (more details), 1.9 Å

PDB Description: crystal structure of elafin complexed with porcine pancreatic elastase
PDB Compounds: (I:) elafin

SCOPe Domain Sequences for d1flei_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1flei_ g.3.14.1 (I:) Elafin, elastase-specific inhibitor {Human (Homo sapiens) [TaxId: 9606]}
tkpgscpiilircamlnppnrclkdtdcpgikkccegscgmacfvpq

SCOPe Domain Coordinates for d1flei_:

Click to download the PDB-style file with coordinates for d1flei_.
(The format of our PDB-style files is described here.)

Timeline for d1flei_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1flee_