Lineage for d1tabi_ (1tab I:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2258855Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families) (S)
  5. 2258856Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins)
  6. 2258857Protein Bowman-Birk inhibitor, BBI [57249] (8 species)
    duplication: consists of two sequence repeats each having this fold
  7. 2258858Species Adzuki bean (Phaseolus angularis) [TaxId:3914] [57255] (1 PDB entry)
  8. 2258859Domain d1tabi_: 1tab I: [44351]
    Other proteins in same PDB: d1tabe_
    partly disordered

Details for d1tabi_

PDB Entry: 1tab (more details), 2.3 Å

PDB Description: structure of the trypsin-binding domain of bowman-birk type protease inhibitor and its interaction with trypsin
PDB Compounds: (I:) bowman-birk type proteinase inhibitor

SCOPe Domain Sequences for d1tabi_:

Sequence, based on SEQRES records: (download)

>d1tabi_ g.3.13.1 (I:) Bowman-Birk inhibitor, BBI {Adzuki bean (Phaseolus angularis) [TaxId: 3914]}
sesskpccdqcsctksmppkcrcsdirlnschsackscactysipakcfctdindfcyep
ck

Sequence, based on observed residues (ATOM records): (download)

>d1tabi_ g.3.13.1 (I:) Bowman-Birk inhibitor, BBI {Adzuki bean (Phaseolus angularis) [TaxId: 3914]}
sesskpccdqcsctksmppkcrcsdirndfcyepck

SCOPe Domain Coordinates for d1tabi_:

Click to download the PDB-style file with coordinates for d1tabi_.
(The format of our PDB-style files is described here.)

Timeline for d1tabi_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tabe_