Class g: Small proteins [56992] (90 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (1 family) |
Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins) |
Protein Bowman-Birk inhibitor, BBI [57249] (8 species) duplication: consists of two sequence repeats each having this fold |
Species Barley (Hordeum vulgare) [TaxId:4513] [57254] (3 PDB entries) further duplication: consist of two BBI domains |
Domain d1c2aa2: 1c2a A:65-123 [44350] |
PDB Entry: 1c2a (more details), 1.9 Å
SCOPe Domain Sequences for d1c2aa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c2aa2 g.3.13.1 (A:65-123) Bowman-Birk inhibitor, BBI {Barley (Hordeum vulgare) [TaxId: 4513]} pweccdkaictrsnpptcrcvdevkkcaptcktclpsrsrpsrrvcidsyfgpvpprct
Timeline for d1c2aa2: