SCOPe 2.03: Domain d1c2aa2: 1c2a A:65-123

Lineage for d1c2aa2 (1c2a A:65-123)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (1 family)

5. Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins)

6. Protein Bowman-Birk inhibitor, BBI [57249] (8 species)
   duplication: consists of two sequence repeats each having this fold

7. Species Barley (Hordeum vulgare) [TaxId:4513] [57254] (3 PDB entries)
   further duplication: consist of two BBI domains

8. Domain d1c2aa2: 1c2a A:65-123 [44350]

Details for d1c2aa2

PDB Entry: 1c2a, 1.9 Å

PDB Description: crystal structure of barley bbi

PDB Compounds: (A:) bowman-birk trypsin inhibitor

SCOPe Domain Sequences for d1c2aa2:

Sequence; same for both SEQRES and ATOM records:

>d1c2aa2 g.3.13.1 (A:65-123) Bowman-Birk inhibitor, BBI {Barley (Hordeum vulgare) [TaxId: 4513]}
pweccdkaictrsnpptcrcvdevkkcaptcktclpsrsrpsrrvcidsyfgpvpprct

Timeline for d1c2aa2:

• d1c2aa2 first appeared (with stable ids) in SCOP 1.55
  
• d1c2aa2 appears in SCOPe 2.02
  
• d1c2aa2 appears in SCOPe 2.04
  
• d1c2aa2 appears in the current release, SCOPe 2.08