Lineage for d1c2aa1 (1c2a A:4-64)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1960255Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1961886Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families) (S)
  5. 1961887Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins)
  6. 1961888Protein Bowman-Birk inhibitor, BBI [57249] (8 species)
    duplication: consists of two sequence repeats each having this fold
  7. Species Barley (Hordeum vulgare) [TaxId:4513] [57254] (1 PDB entry)
    further duplication: consist of two BBI domains
  8. 1961892Domain d1c2aa1: 1c2a A:4-64 [44349]

Details for d1c2aa1

PDB Entry: 1c2a (more details), 1.9 Å

PDB Description: crystal structure of barley bbi
PDB Compounds: (A:) bowman-birk trypsin inhibitor

SCOPe Domain Sequences for d1c2aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c2aa1 g.3.13.1 (A:4-64) Bowman-Birk inhibitor, BBI {Barley (Hordeum vulgare) [TaxId: 4513]}
krpwkccdeavctrsippictcmdevfecpktckscgpsmgdpsrricqdqyvgdpgpic
r

SCOPe Domain Coordinates for d1c2aa1:

Click to download the PDB-style file with coordinates for d1c2aa1.
(The format of our PDB-style files is described here.)

Timeline for d1c2aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c2aa2