Lineage for d1c2aa1 (1c2a A:4-64)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 88440Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 89048Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (1 family) (S)
  5. 89049Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (1 protein)
  6. 89050Protein Bowman-Birk inhibitor, BBI [57249] (6 species)
  7. 89053Species Barley (Hordeum vulgare) [TaxId:4513] [57254] (1 PDB entry)
  8. 89054Domain d1c2aa1: 1c2a A:4-64 [44349]

Details for d1c2aa1

PDB Entry: 1c2a (more details), 1.9 Å

PDB Description: crystal structure of barley bbi

SCOP Domain Sequences for d1c2aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c2aa1 g.3.13.1 (A:4-64) Bowman-Birk inhibitor, BBI {Barley (Hordeum vulgare)}
krpwkccdeavctrsippictcmdevfecpktckscgpsmgdpsrricqdqyvgdpgpic
r

SCOP Domain Coordinates for d1c2aa1:

Click to download the PDB-style file with coordinates for d1c2aa1.
(The format of our PDB-style files is described here.)

Timeline for d1c2aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c2aa2