Lineage for d1pbia_ (1pbi A:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1459078Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1460483Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (1 family) (S)
  5. 1460484Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins)
  6. 1460485Protein Bowman-Birk inhibitor, BBI [57249] (8 species)
    duplication: consists of two sequence repeats each having this fold
  7. 1460499Species Pea (Pisum sativum) [TaxId:3888] [57252] (1 PDB entry)
  8. 1460500Domain d1pbia_: 1pbi A: [44346]

Details for d1pbia_

PDB Entry: 1pbi (more details), 2.7 Å

PDB Description: crystal structure of a bowman-birk inhibitor from pea seeds
PDB Compounds: (A:) bowman-birk proteinase inhibitor

SCOPe Domain Sequences for d1pbia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pbia_ g.3.13.1 (A:) Bowman-Birk inhibitor, BBI {Pea (Pisum sativum) [TaxId: 3888]}
ksaccdtclctksnpptcrcvdvgetchsaclscicaysnppkcqcfdtqkfcykqchns
eleevikn

SCOPe Domain Coordinates for d1pbia_:

Click to download the PDB-style file with coordinates for d1pbia_.
(The format of our PDB-style files is described here.)

Timeline for d1pbia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pbib_