Lineage for d2bbi__ (2bbi -)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39579Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)
  4. 40153Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (1 family) (S)
  5. 40154Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (1 protein)
  6. 40155Protein Bowman-Birk inhibitor, BBI [57249] (6 species)
  7. 40163Species Soybean (Glycine max) [TaxId:3847] [57251] (3 PDB entries)
  8. 40165Domain d2bbi__: 2bbi - [44344]

Details for d2bbi__

PDB Entry: 2bbi (more details)

PDB Description: three-dimensional structure of soybean trypsin(slash)chymotrypsin bowman-birk inhibitor in solution

SCOP Domain Sequences for d2bbi__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bbi__ g.3.13.1 (-) Bowman-Birk inhibitor, BBI {Soybean (Glycine max)}
ddesskpccdqcactksnppqcrcsdmrlnschsackscicalsypaqcfcvditdfcye
pckpseddken

SCOP Domain Coordinates for d2bbi__:

Click to download the PDB-style file with coordinates for d2bbi__.
(The format of our PDB-style files is described here.)

Timeline for d2bbi__: